Antibody data

Product number
ABIN405911
Provider
antibodies-online
Product name
anti-SAYSVFN Motif Domain Containing 1 (SAYSD1) antibody
Provider product page
antibodies-online - ABIN405911
Antibody type
Polyclonal
Antigen
The immunogen for anti-C6orf64 antibody: synthetic peptide directed towards the C terminal of human C6orf64
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian
Host
Rabbit
Antigen sequence
MYVGTRGPEEKKEGEKSAYSVFNPGCEAIQGTLTA
EQLER ELQLRPLAGR
Vial size
50 µg
Provider Type Product Number
- No reagents -