Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA007959 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-SAYSD1
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LFYWMYVGTRGPEEKKEGEKSAYSVFNPGCEAIQG
TLTAEQLERELQLRPLA- Isotype
- IgG
- Vial size
- 100 μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy
Contribution of Antibody-based Protein Profiling to the Human Chromosome-centric Proteome Project (C-HPP)
Tissue profiling of the mammalian central nervous system using human antibody-based proteomics.
Stadler C, Hjelmare M, Neumann B, Jonasson K, Pepperkok R, Uhlén M, Lundberg E
Journal of Proteomics 2012;75(7):2236-2251
Journal of Proteomics 2012;75(7):2236-2251
Contribution of Antibody-based Protein Profiling to the Human Chromosome-centric Proteome Project (C-HPP)
Fagerberg L, Oksvold P, Skogs M, Älgenäs C, Lundberg E, Pontén F, Sivertsson Å, Odeberg J, Klevebring D, Kampf C, Asplund A, Sjöstedt E, Al-Khalili Szigyarto C, Edqvist P, Olsson I, Rydberg U, Hudson P, Ottosson Takanen J, Berling H, Björling L, Tegel H, Rockberg J, Nilsson P, Navani S, Jirström K, Mulder J, Schwenk J, Zwahlen M, Hober S, Forsberg M, von Feilitzen K, Uhlén M
Journal of Proteome Research 2012;12(6):2439-2448
Journal of Proteome Research 2012;12(6):2439-2448
Tissue profiling of the mammalian central nervous system using human antibody-based proteomics.
Mulder J, Björling E, Jonasson K, Wernérus H, Hober S, Hökfelt T, Uhlén M
Molecular & cellular proteomics : MCP 2009 Jul;8(7):1612-22
Molecular & cellular proteomics : MCP 2009 Jul;8(7):1612-22
No comments: Submit comment
No validations: Submit validation data