HPA007959

SAYSD1 antibody from Sigma-Aldrich
C6orf64, FLJ11101
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007959
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007959, RRID:AB_1078359
Product name
Anti-C6orf64 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007959
Antibody type
Polyclonal
Antigen
Uncharacterized protein C6orf64 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LFYWMYVGTRGPEEKKEGEKSAYSVFNPGCEAIQG
TLTAEQLERELQLRPLA
Storage
-20C
Provider Type Product Number
- No reagents -