HPA007959

SAYSD1 antibody from MilliporeSigma / Merck KGaA
C6orf64, FLJ11101
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007959
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA007959, RRID:AB_1078359
Product name
Anti-C6orf64 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA007959
Antibody type
Polyclonal
Antigen
Uncharacterized protein C6orf64 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LFYWMYVGTRGPEEKKEGEKSAYSVFNPGCEAIQG
TLTAEQLERELQLRPLA
Storage
-20C
Provider Type Product Number
- No reagents -