SAB2100315

SAYSD1 antibody from Sigma-Aldrich
C6orf64, FLJ11101
No application information provided.

Antibody data

Product number
SAB2100315
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2100315, RRID:AB_10605383
Product name
Anti-C6ORF64 antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2100315
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_060792.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MYVGTRGPEEKKEGEKSAYSVFNPGCEAIQGTLTA
EQLERELQLRPLAGR
Storage
-20C
Provider Type Product Number
- No reagents -