HPA039761

NAA16 antibody from Atlas Antibodies
FLJ22054, MGC40612, NARG1L, PRO2435
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA039761
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA039761, RRID:AB_10795112
Product name
Anti-NAA16
Provider product page
Atlas Antibodies - HPA039761
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FAINSNNPWLHECLIRFSKSVSNHSNLPDIVSKVL
SQEMQKIFVKKDLESFNEDFLKRNATSLQHLLSGA
KMMYFLDKSRQEKA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -