HPA039761

NAA16 antibody from Atlas Antibodies
FLJ22054, MGC40612, NARG1L, PRO2435

Antibody data

Product number
HPA039761
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA039761, RRID:AB_10795112
Product name
Anti-NAA16
Provider product page
Atlas Antibodies - HPA039761
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FAINSNNPWLHECLIRFSKSVSNHSNLPDIVSKVL
SQEMQKIFVKKDLESFNEDFLKRNATSLQHLLSGA
KMMYFLDKSRQEKA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.