Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311101 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-N(alpha)-Acetyltransferase 16, NatA Auxiliary Subunit (NAA16) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NARG1L antibody: synthetic peptide directed towards the middle region of human NARG1L
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
ASLKTCDFFSPYENGEKEPPTTLLWVQYFLAQHFD
KLGQY SLALDYINAA- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references High-throughput mapping of a dynamic signaling network in mammalian cells.
Barrios-Rodiles M, Brown KR, Ozdamar B, Bose R, Liu Z, Donovan RS, Shinjo F, Liu Y, Dembowy J, Taylor IW, Luga V, Przulj N, Robinson M, Suzuki H, Hayashizaki Y, Jurisica I, Wrana JL
Science (New York, N.Y.) 2005 Mar 11;307(5715):1621-5
Science (New York, N.Y.) 2005 Mar 11;307(5715):1621-5
No comments: Submit comment
No validations: Submit validation data