ABIN311101

NAA16 antibody from antibodies-online
FLJ22054, MGC40612, NARG1L, PRO2435

Antibody data

Product number
ABIN311101
Provider
antibodies-online
Product name
anti-N(alpha)-Acetyltransferase 16, NatA Auxiliary Subunit (NAA16) (Middle Region) antibody
Provider product page
antibodies-online - ABIN311101
Antibody type
Polyclonal
Antigen
The immunogen for anti-NARG1L antibody: synthetic peptide directed towards the middle region of human NARG1L
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine
Host
Rabbit
Antigen sequence
ASLKTCDFFSPYENGEKEPPTTLLWVQYFLAQHFD
KLGQY SLALDYINAA
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -