AV48901

NAA16 antibody from Sigma-Aldrich
FLJ22054, MGC40612, NARG1L, PRO2435
Immunohistochemistry
Recommended by provider

Antibody data

Product number
AV48901
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV48901, RRID:AB_1854312
Product name
Anti-NARG1L antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV48901
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human NARG1L with an internal ID of P28952
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SPYENGEKEPPTTLLWVQYFLAQHFDKLGQYSLAL
DYINAAIASTPTLIE
Storage
-20C
Provider Type Product Number
- No reagents -