SAB2101548

NAA16 antibody from Sigma-Aldrich
FLJ22054, MGC40612, NARG1L, PRO2435
No application information provided.

Antibody data

Product number
SAB2101548
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2101548, RRID:AB_10604628
Product name
Anti-NARG1L antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2101548
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_078837.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RKGKFLLMLQSVKRAFAINSNNPWLHECLIRFSKS
VSNHSNLPDIVSKVL
Storage
-20C
Provider Type Product Number
- No reagents -