H00027231-B01P

NMRK2 antibody from Abnova Corporation
ITGB1BP3, MIBP, NRK2

Antibody data

Product number
H00027231-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00027231-B01P, RRID:AB_1577281
Product name
ITGB1BP3 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00027231-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ITGB1BP3 protein.
Antigen sequence
MKLIVGIGGMTNGGKTTLTNSLLRALPNCCVIHQD
DFFKPQDQIAVGEDGFKQWDVLESLDMEAMLDTVQ
AWLSSPQKFARAHGVSVQPEASDTHILLLEGFLLY
SYKPLVDLYSRRYFLTVPYEECKWRRSTRNYTVPD
PPGLFDGHVWPMYQKYRQEMEANGVEVVYLDGMKS
REELFREVLEDIQNSLLNRSQESAPSPARPARTQG
PGRGCGHRTARPAASQQDSM
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.