HPA072450

NMRK2 antibody from Atlas Antibodies
ITGB1BP3, MIBP, NRK2

Antibody data

Product number
HPA072450
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA072450, RRID:AB_2686522
Product name
Anti-NMRK2
Provider product page
Atlas Antibodies - HPA072450
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VYLDGMKSREELFREVLEDIQNSLLNRSQESAPSP
ARPARTQGPGRGCGHRTARPAASQQDSM
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.