Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1105595 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Chromosome 14 Open Reading Frame 28 (C14orf28) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide corresponding to a middle to C-terminal region of mouse Gm527 (Uncharacterized protein C14orf28 homolog)
- Description
- Immunoaffinity column
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Antigen sequence
CHGAPPFVVLNMQHWKPEDLAYVPYYLDLSDHKYL
LEGATLFNKEEHHYS- Epitope
- C-Term
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C for one month or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Mouse Spleen; WB Suggested Anti-Gm527 Antibody. . Titration: 1.0 ug/ml. . Positive Control: Mouse Spleen; Gm527 antibody - C-terminal region (AP46089PU-N) in Mouse Spleen cells using Western Blot