PAB20377

SMIM8 antibody from Abnova Corporation
C6orf162, dJ102H19.2, DKFZP586E1923

Antibody data

Product number
PAB20377
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20377, RRID:AB_10967120
Product name
C6orf162 polyclonal antibody
Provider product page
Abnova Corporation - PAB20377
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant C6orf162.
Antigen sequence
MSSAPEPPTFKKEPPKEKEFQSPGLRGVRTTTLFR
AVNPELFIKPNKP
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.