HPA007401

SMIM8 antibody from Atlas Antibodies
C6orf162, dJ102H19.2, DKFZP586E1923
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007401
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007401, RRID:AB_889058
Product name
Anti-SMIM8
Provider product page
Atlas Antibodies - HPA007401
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MSSAPEPPTFKKEPPKEKEFQSPGLRGVRTTTLFR
AVNPELFIKPNKP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -