HPA007401

SMIM8 antibody from Sigma-Aldrich
C6orf162, dJ102H19.2, DKFZP586E1923
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007401
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007401, RRID:AB_1078357
Product name
Anti-C6orf162 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007401
Antibody type
Polyclonal
Antigen
UPF0708 protein C6orf162 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MSSAPEPPTFKKEPPKEKEFQSPGLRGVRTTTLFR
AVNPELFIKPNKP
Storage
-20C
Provider Type Product Number
- No reagents -