WH0008227M2

AKAP17A antibody from Sigma-Aldrich
721P, CCDC133, CXYorf3, DXYS155E, MGC39904, SFRS17A, XE7, XE7Y
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider

Antibody data

Product number
WH0008227M2
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0008227M2, RRID:AB_1841380
Product name
Monoclonal Anti-RP13-297E16.1 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0008227M2
Antibody type
Monoclonal
Antigen
RP13-297E16.1 (NP_005079, a.a. 53-157) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human, Mouse
Antigen sequence
ERLKGMVQNHQFSTLRISKSTMDFIRFEGEVENKS
LVKSFLACLDGKTIKLSGFSDILKVRAAEFKIDFP
TRHDWDSFFRDAKDMNETLPGERPDTIHLEGLPC*
(without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -