HPA043247

AKAP17A antibody from Atlas Antibodies
721P, CCDC133, CXYorf3, DXYS155E, MGC39904, SFRS17A, XE7, XE7Y
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA043247
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA043247, RRID:AB_10964776
Product name
Anti-AKAP17A
Provider product page
Atlas Antibodies - HPA043247
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GEVENKSLVKSFLACLDGKTIKLSGFSDILKVRAA
EFKIDFPTRHDWDSFFRDAKDMNETLPGERPDTIH
LEGLPCKWFALKESGSEKPSEDVLVKVF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -