H00008227-M02

AKAP17A antibody from Abnova Corporation
721P, CCDC133, CXYorf3, DXYS155E, MGC39904, SFRS17A, XE7, XE7Y

Antibody data

Product number
H00008227-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008227-M02, RRID:AB_530237
Product name
SFRS17A monoclonal antibody (M02), clone 2G8
Provider product page
Abnova Corporation - H00008227-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant RP13-297E16.1.
Antigen sequence
ERLKGMVQNHQFSTLRISKSTMDFIRFEGEVENKS
LVKSFLACLDGKTIKLSGFSDILKVRAAEFKIDFP
TRHDWDSFFRDAKDMNETLPGERPDTIHLEGLPC
Isotype
IgG
Antibody clone number
2G8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -