HPA012059

B3GAT2 antibody from Sigma-Aldrich
GlcAT-S
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012059
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012059, RRID:AB_2061050
Product name
Anti-B3GAT2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012059
Antibody type
Polyclonal
Antigen
Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PVGLVGGRRYERPLVENGKVVGWYTGWRADRPFAI
DMAGFAVSLQVILSNPKAVFKRRGSQPGMQESDFL
KQITTVEELEPKANNCTKVLVWHTRTEKVNLANEP
KYHLDTVK
Storage
-20C
Provider Type Product Number
- No reagents -