Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA007547 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA007547, RRID:AB_1079430
- Product name
- Anti-ULBP1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
THCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHY
DCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVD
FLKGQLLDIQVENLIPIEPLTLQARMS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references NKG2D ligand expression in pediatric brain tumors
Role of NKG2D, DNAM-1 and natural cytotoxicity receptors in cytotoxicity toward rhabdomyosarcoma cell lines mediated by resting and IL-15-activated human natural killer cells
MICA/B and ULBP1 NKG2D ligands are independent predictors of good prognosis in cervical cancer
NKG2D ligand tumor expression and association with clinical outcome in early breast cancer patients: an observational study.
Haberthur K, Brennan K, Hoglund V, Balcaitis S, Chinn H, Davis A, Kreuser S, Winter C, Leary S, Deutsch G, Ellenbogen R, Crane C
Cancer Biology & Therapy 2016;17(12):1253-1265
Cancer Biology & Therapy 2016;17(12):1253-1265
Role of NKG2D, DNAM-1 and natural cytotoxicity receptors in cytotoxicity toward rhabdomyosarcoma cell lines mediated by resting and IL-15-activated human natural killer cells
Boerman G, van Ostaijen-ten Dam M, Kraal K, Santos S, Ball L, Lankester A, Schilham M, Egeler R, van Tol M
Cancer Immunology, Immunotherapy 2015;64(5):573-583
Cancer Immunology, Immunotherapy 2015;64(5):573-583
MICA/B and ULBP1 NKG2D ligands are independent predictors of good prognosis in cervical cancer
Cho H, Chung J, Kim S, Braunschweig T, Kang T, Kim J, Chung E, Hewitt S, Kim J
BMC Cancer 2014;14(1)
BMC Cancer 2014;14(1)
NKG2D ligand tumor expression and association with clinical outcome in early breast cancer patients: an observational study.
de Kruijf EM, Sajet A, van Nes JG, Putter H, Smit VT, Eagle RA, Jafferji I, Trowsdale J, Liefers GJ, van de Velde CJ, Kuppen PJ
BMC cancer 2012 Jan 18;12:24
BMC cancer 2012 Jan 18;12:24
No comments: Submit comment
No validations: Submit validation data