Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310516 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 4 (SLC7A4) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLC7A4 antibody: synthetic peptide directed towards the middle region of human SLC7A4
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Zebrafish
- Host
- Rabbit
- Antigen sequence
GAYILVSTVLTLMVPWHSLDPDSALADAFYQRGYR
WAGFI VAAGSICAMN- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A genome annotation-driven approach to cloning the human ORFeome.
Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I
Genome biology 2004;5(10):R84
Genome biology 2004;5(10):R84
No comments: Submit comment
No validations: Submit validation data