Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00133396-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00133396-M01, RRID:AB_565869
- Product name
- IL31RA monoclonal antibody (M01), clone 3A10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant IL31RA.
- Antigen sequence
LPAKPENISCVYYYRKNLTCTWSPGKETSYTQYTV
KRTYAFGEKHDNCTTNSSTSENRASCSFFLPRITI
PDNYTIEVEAENGDGVIKSHMTYWRLENIA- Isotype
- IgG
- Antibody clone number
- 3A10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of IL31RA expression in transfected 293T cell line by IL31RA monoclonal antibody (M01), clone 3A10.Lane 1: IL31RA transfected lysate(83 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to IL31RA on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol