Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405762 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Diacylglycerol Kinase, eta (DGKH) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-DGKH antibody: synthetic peptide directed towards the middle region of human DGKH
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Zebrafish
- Host
- Rabbit
- Antigen sequence
DLDSVDGYSEKCVMNNYFGIGLDAKISLEFNNKRE
EHPEK CRSRTKNLMW- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A genome-wide association study implicates diacylglycerol kinase eta (DGKH) and several other genes in the etiology of bipolar disorder.
Baum AE, Akula N, Cabanero M, Cardona I, Corona W, Klemens B, Schulze TG, Cichon S, Rietschel M, Nöthen MM, Georgi A, Schumacher J, Schwarz M, Abou Jamra R, Höfels S, Propping P, Satagopan J, Detera-Wadleigh SD, Hardy J, McMahon FJ
Molecular psychiatry 2008 Feb;13(2):197-207
Molecular psychiatry 2008 Feb;13(2):197-207
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Immunohistochemistry