Antibody data

Product number
H00007358-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007358-M01A, RRID:AB_1137521
Product name
UGDH monoclonal antibody (M01A), clone 1B7
Provider product page
Abnova Corporation - H00007358-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant UGDH.
Antigen sequence
VTISKDPYEACDGAHAVVICTEWDMFKELDYERIH
KKMLKPAFIFDGRRVLDGLHNELQTIGFQIETIGK
KVSSKRIPYAPSGEIPKFSLQDPPNKKPKV
Isotype
IgM
Antibody clone number
1B7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -