H00030844-M02

EHD4 antibody from Abnova Corporation
PAST4
No application information provided.

Antibody data

Product number
H00030844-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00030844-M02, RRID:AB_1136925
Product name
EHD4 monoclonal antibody (M02), clone 1B5
Provider product page
Abnova Corporation - H00030844-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant EHD4.
Antigen sequence
MFSWMGRQAGGRERAGGADAVQTVTGGLRSLYLRK
VLPLEEAYRFHEFHSPALEDADFENKPMILLVGQY
STGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMY
GETEGSTPGNALVVDPKKPFRKLSRFGNAFLNRFM
CSQLPNQVLKSISVIDSPGILSGEKQRISRGYDFC
QVLQWFAERVDRIILLFDAHKLDISDEFSEAIKAF
RGQDDKIRVVLNKADQVDTQQLMRVYGALMWSLGK
VINTPEVLRVYIGSFWAQPLQNTDNRRLFEAEAQD
LFRDIQSLPQKAAVRKLNDLIKRARLAKVHAYIIS
YLKKEMPSVFGKENKKRELISRLPEIYIQLQREYQ
ISAGDFPEVKAMQEQLENYDFTKFHSLKPKLIEAV
DNMLSNKISPLMNLISQEETSTPTQLVQGGAFDGT
TEGPFNQGYGEGAKEGADEEEWVVAKDKPVYDELF
YTLSPINGKISGVNAKKEMVTSKLPNSVLGKIWKL
ADCDCDGMLDEEEFALAKHLIKIKLDGYELPSSLP
PHLVPPSHRKSLPKAD
Isotype
IgG
Antibody clone number
1B5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -