HPA007455

MRPL2 antibody from Sigma-Aldrich
CGI-22, MRP-L14, RPML14
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007455
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007455, RRID:AB_1079410
Product name
Anti-MRPL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007455
Antibody type
Polyclonal
Antigen
39S ribosomal protein L2, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PAPSLFPAAQMMNNGLLQQPSALMLLPCRPVLTSV
ALNANFVSWKSRTKYTITPVKMRKSGGRDHTGRIR
VHGIGGGHKQRYRMIDFLRFRPEETKSGPFEEKVI
QVRYDP
Storage
-20C
Provider Type Product Number
- No reagents -