H00001826-A01

DSCAM antibody from Abnova Corporation
CHD2-42, CHD2-52
No application information provided.

Antibody data

Product number
H00001826-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001826-A01, RRID:AB_463066
Product name
DSCAM polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00001826-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant DSCAM.
Antigen sequence
KDVQNEDGLYNYRCITRHRYTGETRQSNSARLFVS
DPANSAPSILDGFDHRKAMAGQRVELPCKALGHPE
PDYRWLKDNMPLELSGRF
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -