SAB1402080

PLA2G4D antibody from MilliporeSigma / Merck KGaA
cPLA2delta
No application information provided.

Antibody data

Product number
SAB1402080
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#SAB1402080, RRID:AB_10608825
Product name
Anti-PLA2G4D antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - SAB1402080
Antibody type
Polyclonal
Antigen
PLA2G4D (AAH34571.1, 1- 216 a.a) full-length human protein.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MGRLMRRIPEPRICFLEAIWSNIFSLNLLDAWYDL
TSSGESWKQHIKDKTRSLEKEPLTTSGTSSRLEAS
WLQPGTALAQAFKGFLTGRPLHQRSPNFLQGLQLH
QDYCSHKDFSTWADYQLDSMPSQLTPKEPRLCLVD
AAYFINTSSPSMFRPGRRLDLILSFDYSLSAPFEV
PWSPQGNPSAQPGQAPEASSRATEPLPHTARVPKG
RRGVRP
Storage
-20C
Provider Type Product Number
- No reagents -