HPA007167

CDH9 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007167
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007167, RRID:AB_1078489
Product name
Anti-CDH9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007167
Antibody type
Polyclonal
Antigen
Cadherin-9 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GIITVKQNLDFENQMLYTLRVDASNTHPDPRFLHL
GPFKDTAVVKISVEDIDEPPVFTKVSYLIEVDEDV
KEGSIIGQVTAYDPDARNNLIKYSVDRHTDMDRI
Storage
-20C
Provider Type Product Number
- No reagents -