HPA000436

MORC2 antibody from Sigma-Aldrich
AC004542.C22.1, KIAA0852, ZCW3, ZCWCC1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000436
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000436, RRID:AB_1079404
Product name
Anti-MORC2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000436
Antibody type
Polyclonal
Antigen
MORC family CW-type zinc finger protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TSECLRIEPDTTALSTNHETIDLLVQILRNCLRYF
LPPSFPISKKQLSAMNSDELISFPLKEYFKQYEVG
LQNLCNSYQSRADSRAKASEESLRTSERKLRETEE
KLQKLRTNIVALLQKVQEDIDINTDDELDAYIED
Storage
-20C
Provider Type Product Number
- No reagents -