HPA013191

PCDHB5 antibody from MilliporeSigma / Merck KGaA
DKFZp586B0217, PCDH-BETA5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013191
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA013191, RRID:AB_1855059
Product name
Anti-PCDHB5 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA013191
Antibody type
Polyclonal
Antigen
Protocadherin beta-5 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HYKGNKELLQLDIKTGNLLLYEKLDREVMCGATEP
CILHFQLLLENPVQFFQTDLQLTDINDHAPEFPEK
EMLLKIPESTQPGTVFPLKIAQDFDIGSNTVQNY
Storage
-20C
Provider Type Product Number
- No reagents -