Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [10]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA023644 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA023644, RRID:AB_10598916
- Product name
- Anti-STAR
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
QDNGDKVMSKVVPDVGKVFRLEVVVDQPMERLYEE
LVERMEAMGEWNPNVKEIKVLQKIGKDTFITHELA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The emerging role of the molecular marker p27 in the differential diagnosis of adrenocortical tumors.
Pereira SS, Morais T, Costa MM, Monteiro MP, Pignatelli D
Endocrine connections 2013;2(3):137-45
Endocrine connections 2013;2(3):137-45
No comments: Submit comment
Enhanced validation
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human adrenal gland and skeletal muscle tissues using HPA023644 antibody. Corresponding STAR RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human adrenal gland, kidney, lymph node and testis using Anti-STAR antibody HPA023644 (A) shows similar protein distribution across tissues to independent antibody HPA027318 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of adrenal gland shows strong cytoplasmic positivity in corticla cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human adrenal gland shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows low expression as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong positivity in mitochondria in Leydig cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human adrenal gland shows strong positivity in mitochondria in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney using Anti-STAR antibody HPA023644.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node using Anti-STAR antibody HPA023644.
- Sample type
- HUMAN