Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006770-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006770-M01, RRID:AB_519069
- Product name
- STAR monoclonal antibody (M01), clone 5F9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant STAR.
- Antigen sequence
EAMQKALGILSNQEGWKKESQQDNGDKVMSKVVPD
VGKVFRLEVVVDQPMERLYEELVERMEAMGEWNPN
VKEIKVLQKIGKDTFITHELAAEAAGNLVG- Isotype
- IgG
- Antibody clone number
- 5F9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Tissue culture media supplemented with 10% fetal calf serum contains a castrate level of testosterone.
Sedelaar JP, Isaacs JT
The Prostate 2009 Dec 1;69(16):1724-9
The Prostate 2009 Dec 1;69(16):1724-9
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of STAR expression in transfected 293T cell line by STAR monoclonal antibody (M01), clone 5F9.Lane 1: STAR transfected lysate(31.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged STAR is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol