HPA023644

STAR antibody from Sigma-Aldrich
StAR, STARD1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023644
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023644, RRID:AB_10598916
Product name
Anti-STAR antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023644
Antibody type
Polyclonal
Antigen
steroidogenic acute regulatory protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QDNGDKVMSKVVPDVGKVFRLEVVVDQPMERLYEE
LVERMEAMGEWNPNVKEIKVLQKIGKDTFITHELA
Storage
-20C
Provider Type Product Number
- No reagents -