HPA027318

STAR antibody from Sigma-Aldrich
StAR, STARD1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027318
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027318, RRID:AB_10601574
Product name
Anti-STAR antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027318
Antibody type
Polyclonal
Antigen
steroidogenic acute regulatory protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TCVLAGMATDFGNMPEQKGVIRAEHGPTCMVLHPL
AGSPSKTKLTWLLSIDLKGWLPKSIINQVLSQTQV
DFAN
Storage
-20C
Provider Type Product Number
- No reagents -