Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405680 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Arylsulfatase H (ARSH) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ARSH antibody: synthetic peptide directed towards the middle region of human ARSH
- Description
- Affinity Purified
- Reactivity
- Human, Rat, Canine
- Host
- Rabbit
- Antigen sequence
FIERYKREPFLLFFSFLHVHTPLISKKKFVGRSKY
GRYGD NVEEMDWMVG- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Sulfatases and sulfatase modifying factors: an exclusive and promiscuous relationship.
Sardiello M, Annunziata I, Roma G, Ballabio A
Human molecular genetics 2005 Nov 1;14(21):3203-17
Human molecular genetics 2005 Nov 1;14(21):3203-17
No comments: Submit comment
No validations: Submit validation data