Antibody data

Product number
ABIN405680
Provider
antibodies-online
Product name
anti-Arylsulfatase H (ARSH) (Middle Region) antibody
Provider product page
antibodies-online - ABIN405680
Antibody type
Polyclonal
Antigen
The immunogen for anti-ARSH antibody: synthetic peptide directed towards the middle region of human ARSH
Description
Affinity Purified
Reactivity
Human, Rat, Canine
Host
Rabbit
Antigen sequence
FIERYKREPFLLFFSFLHVHTPLISKKKFVGRSKY
GRYGD NVEEMDWMVG
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -