SAB1400867

ARSH antibody from Sigma-Aldrich
ELISA
Recommended by provider

Antibody data

Product number
SAB1400867
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1400867, RRID:AB_1845058
Product name
Anti-ARSH antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1400867
Antibody type
Polyclonal
Antigen
ARSH (AAI53086.1, a.a. 1-562) full-length human protein.
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
MTRNARPNIVLLMADDLGVGDLCCYGNNSVSTPNI
DRLASEGVRLTQHLAAASMCTPSRAAFLTGRYPIR
SGMVSAYNLNRAFTWLGGSGGLPTNETTFAKLLQH
RGYRTGLIGKWHLGLSCASRNDHCYHPLNHGFHYF
YGVPFGLLSDCQASKTPELHRWLRIKLWISTVALA
LVPFLLLIPKFARWFSVPWKVIFVFALLAFLFFTS
WYSSYGFTRRWNCILMRNHEIIQQPMKEEKVASLM
LKEALAFIERYKREPFLLFFSFLHVHTPLISKKKF
VGRSKYGRYGDNVEEMDWMVGKILDALDQERLANH
TLVYFTSDNGGHLEPLDGAVQLGGWNGIYKGGKGM
GGWEGGIRVPGIFRWPSVLEAGRVINEPTSLMDIY
PTLSYIGGGILSQDRVIDGQNLMPLLEGRASHSDH
EFLFHYCGVYLHTVRWHQKDCATVWKAHYVTPKFY
Storage
-20C
Provider Type Product Number
- No reagents -