SAB2100157

ARSH antibody from Sigma-Aldrich
No application information provided.

Antibody data

Product number
SAB2100157
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2100157, RRID:AB_10602826
Product name
Anti-ARSH antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2100157
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_001011719.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FIERYKREPFLLFFSFLHVHTPLISKKKFVGRSKY
GRYGDNVEEMDWMVG
Storage
-20C
Provider Type Product Number
- No reagents -