HPA007172

PCDHB15 antibody from Atlas Antibodies
PCDH-BETA15
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007172
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007172, RRID:AB_1079576
Product name
Anti-PCDHB15
Provider product page
Atlas Antibodies - HPA007172
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PRRYSVMEETERGSFVANLANDLGLGVGELAERGA
RVVSEDNEQGLQLDLQTGQLILNEKLDREKLCGPT
EPCIMHFQVLLKKPLEVFRAELLVTDINDHSPEFP
EREMTLKIP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -