HPA007172

PCDHB15 antibody from Sigma-Aldrich
PCDH-BETA15
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007172
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007172, RRID:AB_1079576
Product name
Anti-PCDHB15 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007172
Antibody type
Polyclonal
Antigen
Protocadherin beta 15 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PRRYSVMEETERGSFVANLANDLGLGVGELAERGA
RVVSEDNEQGLQLDLQTGQLILNEKLDREKLCGPT
EPCIMHFQVLLKKPLEVFRAELLVTDINDHSPEFP
EREMTLKIP
Storage
-20C
Provider Type Product Number
- No reagents -