HPA041479

RBFA antibody from Atlas Antibodies
C18orf22, FLJ21172, HsT169
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA041479
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA041479, RRID:AB_10795697
Product name
Anti-RBFA
Provider product page
Atlas Antibodies - HPA041479
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DPDAPQPCGTTEPTTSSSLCGIDHEALNKQIMEYK
RRKDKGLGGLVWQGQVAELTTQMKKGRKRAKPRLE
QDSSLKSYLSGEEVEDDLDLVGAPEYECYA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -