H00079863-B01P

RBFA antibody from Abnova Corporation
C18orf22, FLJ21172, HsT169

Antibody data

Product number
H00079863-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00079863-B01P, RRID:AB_1572616
Product name
C18orf22 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00079863-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human C18orf22 protein.
Antigen sequence
MWAAAGGLWRSRAGLRALFRSRDAALFPGCERGLH
CSAVSCKNWLKKFASKTKKKVWYESPSLGSHSTYK
PSKLEFLMRSTSKKTRKEDHARLRALNGLLYKALT
DLLCTPEVSQELYDLNVELSKVSLTPDFSACRAYW
KTTLSAEQNAHMEAVLQRSAAHMRHLLMSQQTLRN
VPPIVFVQDKGNAALAELDQLLAVADFGPRDERDN
FVQNDFRDPDAPQPCGTTEPTTSSSLCGIDHEALN
KQIMEYKRRKDKGLGGLVWQGQVAELTTQMQKGRK
RAKPRLEQDSSLKSYLSGEEVEDDLDLVGAPEYEC
YAPDTEELEAERGGGRTEDGHSCGASRE
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -