H00055068-B01

ENOX1 antibody from Abnova Corporation
cCNOX, CNOX, FLJ10094, PIG38

Antibody data

Product number
H00055068-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00055068-B01, RRID:AB_1204924
Product name
RP11-301I17.1 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00055068-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human RP11-301I17.1 protein.
Antigen sequence
MVDAGGVENITQLPQELPQMMAAAADGLGSIAIDT
TQLNMSVTDPTAWATAMNNLGMVPVGLPGQQLVSD
SICVPGFDPSLNMMTGITPINPMIPGLGLVPPPPP
TEVAVVKEIIHCKSCTLFPQNPNLPPPSTRERPPG
CKTVFVGGLPENATEEIIQEVFEQCGDITAIRKSK
KNFCHIRFAEEFMVDKAIYLSGYRMRLGSSTDKKD
SGRLHVDFAQARDDFYEWECKQRMRAREERHRRKL
EEDRLRPPSPPAIMHYSEHEAALLAEKLKDDSKFS
EAITVLLSWIERGEVNRRSANQFYSMVQSANSHVR
RLMNEKATHEQEMEEAKENFKNALTGILTQFEQIV
AVFNASTRQKAWDHFSKAQRKNIDIWRKHSEELRN
AQSEQLMGIRREEEMEMSDDENCDSPTKKMRVDES
ALAAQAYALKEENDSLRWQLDAYRNEVELLKQEKE
QLFRTEENLTKDQQLQFLQQTMQGMQQQLLTIQEE
LNNKKSELEQAKEEQSHTQALLKVLQEQLKGTKEL
VETNGHSHEDSNEINVLTVALVNQDRENNIEKRSQ
GLKSEKEALLIGIISTFLHVHPFGANIEYLWSYMQ
QLDSKISANEIEMLLMRLPRMFKQEFTGVGATLEK
RWKLCAFEGIKTT
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -