H00026762-M03

HAVCR1 antibody from Abnova Corporation
CD365, HAVCR, HAVCR-1, KIM1, TIM-1, TIM1, TIMD1

Antibody data

Product number
H00026762-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00026762-M03, RRID:AB_1136943
Product name
HAVCR1 monoclonal antibody (M03), clone 2G11
Provider product page
Abnova Corporation - H00026762-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant HAVCR1.
Antigen sequence
MHPQVVILSLILHLADSVAGSVKVGGEAGPSVTLP
CHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVT
YRKDTRYKLLGDLSRRDVSLTIENTAVSDSGVYCC
RVEHRGWFNDMKITVSLEIVPPKVTTTPIVTTVPT
VTTVRTSTTVPTTTTVPMTTVPTTTVPTTMSIPTT
TTVLTTMTVSTTTSVPTTTSIPTTTSVPVTTTVST
FVPPMPLPRQNHEPVATSPSSPQPAETHLTTLQGA
IRREPTSSPLYSYTTDGNDTVTESSDGLWNNNQTQ
LFLEHSLLTANTTKGIYAGVCISVLVLLALLGVII
AKKYFFKREVQQLSVSFSSLQIKALQNAVEKEVQA
EDNIYIENSLYATD
Isotype
IgG
Antibody clone number
2G11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -