HPA007173

HAVCR1 antibody from Sigma-Aldrich
CD365, HAVCR, HAVCR-1, TIM-1, TIM1, TIMD1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007173
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007173, RRID:AB_1080282
Product name
Anti-HAVCR1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007173
Antibody type
Polyclonal
Antigen
Hepatitis A virus cellular receptor 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GPSVTLPCHYSGAVTSMCWNRGSCSLFTCQNGIVW
TNGTHVTYRKDTRYKLLGDLSRRDVSLTIENTAVS
DSGVYCCRVEHRGWFNDMKITVSLEIVPPKVTTTP
IVTTVPTVTTVRTSTT
Storage
-20C
Provider Type Product Number
- No reagents -