HPA027555

POLE2 antibody from Sigma-Aldrich
DPE2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027555
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027555, RRID:AB_10610282
Product name
Anti-POLE2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027555
Antibody type
Polyclonal
Antigen
polymerase (DNA directed), epsilon 2 (p59 subunit) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NAVEKQPLSSNMIERSVVEAAVQECSQSVDETIEH
VFNIIGAFDIPRFVYNSERKKFLPLLMTNHPAPNL
FGTPRDKAEMFRERYTILHQRTHRHELFTPPVIGS
HPDESGSKFQLKTIETLLGSTTKIGDAIVLG
Storage
-20C
Provider Type Product Number
- No reagents -