HPA040150

LACC1 antibody from Atlas Antibodies
C13orf31, FAMIN, FLJ38725

Antibody data

Product number
HPA040150
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA040150, RRID:AB_10963540
Product name
Anti-LACC1
Provider product page
Atlas Antibodies - HPA040150
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FGLKLNSQKNCHQTLLKTLNAVQYHHAAKAKFLCI
MCCSNISYERDGEQDNCEIETSNGLSALLEEFEIV
SCPSMAATLYTIKQKIDEKNLSSIKVI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.