Antibody data

Product number
H00144811-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00144811-M04, RRID:AB_10719931
Product name
C13orf31 monoclonal antibody (M04), clone 2A1
Provider product page
Abnova Corporation - H00144811-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant C13orf31.
Antigen sequence
MAEAVLIDLFGLKLNSQKNCHQTLLKTLNAVQYHH
AAKAKFLCIMCCSNISYERDGEQDNCEIETSNGLS
ALLEEFEIVSCPSMAATLYTIKQKIDEKNLSSIKV
IVPRHRKTLMKAFIDQLFTDVYNFEFEDLQVTFRG
GLFKQSIEINVITAQELRGIQNEIETFLRSLPALR
GKLTIITSSLIPDIFIHGFTTRTGGISYIPTLSSF
NLFSSSKRRDPKVVVQENLRRLANAAGFNVEKFYR
IKTHHSNDIWIMGRKEPDSYDGITTNQRGVTIAAL
GADCIPIVFADPVKKACGVAHAGWKGTLLGVAMAT
VNAMIAEYGCSLEDIVVVLGPSVGPCCFTLPRESA
EAFHNLHPACVQLFDSPNPCIDIRKATRILLEQGG
ILPQNIQDQNQDLNLCTSCHPDKFFSHVRDGLNFG
TQIGFISIKE
Isotype
IgG
Antibody clone number
2A1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.