SAB1402012

LACC1 antibody from MilliporeSigma / Merck KGaA
C13orf31, FAMIN, FLJ38725
No application information provided.

Antibody data

Product number
SAB1402012
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-C13orf31 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - SAB1402012
Antibody type
Polyclonal
Antigen
FLJ38725 (AAH35749.1, 1 - 430 a.a) full-length human protein.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MAEAVLIDLFGLKLNSQKNCHQTLLKTLNAVQYHH
AAKAKFLCIMCCSNISYERDGEQDNCEIETSNGLS
ALLEEFEIVSCPSMAATLYTIKQKIDEKNLSSIKV
IVPRHRKTLMKAFIDQLFTDVYNFEFEDLQVTFRG
GLFKQSIEINVITAQELRGIQNEIETFLRSLPALR
GKLTIITSSLIPDIFIHGFTTRTGGISYIPTLSSF
NLFSSSKRRDPKVVVQENLRRLANAAGFNVEKFYR
IKTHHSNDIW
Storage
-20C