Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA007047 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA007047, RRID:AB_1078374
- Product name
- Anti-CDH6
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LDRETLLWHNITVIATEINNPKQSSRVPLYIKVLD
VNDNAPEFAEFYETFVCEKAKADQLIQTLHAVDKD
DPYSGHQFSFSLAPEAASGSNFTIQDNKDNTAGIL
TRKNGYNRHEMSTYLLP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Cadherin 6 is a new RUNX2 target in TGF-β signalling pathway.
Directing human embryonic stem cell differentiation towards a renal lineage generates a self-organizing kidney
Sancisi V, Gandolfi G, Ragazzi M, Nicoli D, Tamagnini I, Piana S, Ciarrocchi A
PloS one 2013;8(9):e75489
PloS one 2013;8(9):e75489
Directing human embryonic stem cell differentiation towards a renal lineage generates a self-organizing kidney
Takasato M, Er P, Becroft M, Vanslambrouck J, Stanley E, Elefanty A, Little M
Nature Cell Biology 2013 December;16(1):118-126
Nature Cell Biology 2013 December;16(1):118-126
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human kidney and lymph node tissues using Anti-CDH6 antibody. Corresponding CDH6 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node shows low expression as expected.
- Sample type
- HUMAN