HPA007047

CDH6 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007047
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007047, RRID:AB_1078374
Product name
Anti-CDH6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007047
Antibody type
Polyclonal
Antigen
Cadherin-6 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LDRETLLWHNITVIATEINNPKQSSRVPLYIKVLD
VNDNAPEFAEFYETFVCEKAKADQLIQTLHAVDKD
DPYSGHQFSFSLAPEAASGSNFTIQDNKDNTAGIL
TRKNGYNRHEMSTYLLP
Storage
-20C
Provider Type Product Number
- No reagents -